Sermorelin (5MG)

What Is Sermorelin?

Sermorelin is a synthetic 29-amino acid peptide with the sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2. It corresponds to the N-terminal 1-29 fragment of the 44-amino acid endogenous growth hormone-releasing hormone (GHRH). Researchers have established that this 29-residue fragment retains the full biological activity of the native hormone, as the first 29 residues contain the complete receptor-binding domain. For those looking to buy Sermorelin in Switzerland, Core Peptides offers high-quality research-grade material for laboratory applications.

Researchers classify Sermorelin as a synthetic peptide analog within the category of pharmaceutical-grade research materials. Its molecular formula is C149H246N44O42S with a molecular weight of approximately 3,357.9 g/mol, and it is identified by CAS number 86168-78-7. The peptide features C-terminal amidation, which contributes to its biological stability.

Sermorelin Research Overview

Sermorelin has attracted sustained scientific interest as a well-characterized GHRH analog with an extensive research history spanning over four decades in growth hormone physiology. Unlike direct administration of exogenous growth hormone, Sermorelin stimulates the pituitary gland to produce and secrete endogenous GH. This mode of action preserves the natural pulsatile release of GH and remains subject to the body’s own negative feedback mechanisms, primarily through somatostatin, which mitigates the risk of overdose.

Research interest in Sermorelin centers on its ability to bind the GHRH receptor (GHRH-R) on somatotroph cells of the anterior pituitary, activating intracellular signaling cascades that lead to growth hormone synthesis and secretion. Consequently, Sermorelin has generated significant interest as a research tool for investigating GHRH receptor pharmacology, somatotroph function, the hypothalamic-pituitary-somatotroph axis, and growth hormone physiology.

When researchers choose to buy Sermorelin in Switzerland for laboratory studies, they gain access to a compound that may help elucidate mechanisms of GHRH receptor signaling, cAMP-mediated transcription, and growth hormone regulation at the molecular level.

How Does Sermorelin Work?

Sermorelin exerts its biological effects through binding to the growth hormone-releasing hormone receptor (GHRH-R), a member of the G-protein coupled receptor (GPCR) superfamily predominantly expressed on the surface of somatotroph cells in the anterior pituitary gland. The peptide’s mechanism involves several well-characterized steps.

GHRH Receptor Binding and Activation

Sermorelin, as a GHRH analog, competitively binds to the GHRH-R. This binding induces a conformational change in the receptor, which in turn activates its associated heterotrimeric G-protein. The G-protein primarily associated with the GHRH-R is the stimulatory G-protein, Gs.

cAMP/PKA Signaling Pathway

Upon activation of the Gs protein, a cascade of intracellular signaling events is initiated. The primary and most well-elucidated pathway is the cyclic adenosine monophosphate (cAMP) / Protein Kinase A (PKA) pathway. The activation of the Gs alpha subunit by the sermorelin-bound GHRH-R leads to the stimulation of adenylyl cyclase. This enzyme catalyzes the conversion of ATP to cyclic AMP (cAMP). The subsequent increase in intracellular cAMP levels activates Protein Kinase A (PKA).

Activated PKA then phosphorylates various downstream targets, including the transcription factor cAMP response element-binding protein (CREB). Phosphorylated CREB translocates to the nucleus and binds to cAMP response elements (CRE) in the promoter region of the growth hormone gene, thereby enhancing its transcription. This leads to an increased synthesis of GH mRNA and, consequently, growth hormone.

The PLC/IP3/DAG Signaling Pathway

In addition to the primary cAMP/PKA pathway, sermorelin-mediated activation of the GHRH-R can also stimulate Phospholipase C (PLC) through the βγ-subunits of the G-protein. PLC activation leads to the hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP2) into two second messengers: inositol trisphosphate (IP3) and diacylglycerol (DAG). This secondary pathway contributes to the overall physiological effect.

Researchers who buy Sermorelin in Switzerland for research purposes can investigate these mechanisms across diverse experimental models of GHRH receptor signaling, somatotroph function, and growth hormone physiology.

Why Is Sermorelin Studied?

Researchers study Sermorelin primarily for its potential relevance to GHRH receptor pharmacology, somatotroph function, and growth hormone physiology. The peptide’s ability to selectively activate the GHRH receptor and stimulate endogenous GH secretion makes it a valuable tool for understanding the molecular basis of the hypothalamic-pituitary-somatotroph axis.

Researchers have studied Sermorelin as a diagnostic agent for growth hormone deficiency. Unlike direct GH injection, Sermorelin works by signaling the pituitary gland to release endogenous growth hormone. Clinical evidence supports its use as a diagnostic agent for GH assessment, and researchers have explored it in the context of adult GH deficiency and age-related GH decline.

Moreover, researchers study Sermorelin in the context of the natural feedback architecture of the hypothalamic-pituitary-somatotroph axis. In research models, Sermorelin serves as a tool that preserves sensitivity to somatostatin-mediated inhibition, offering a more physiologically relevant approach to investigating growth hormone regulation compared to direct GH administration.

Researchers who buy Sermorelin in Switzerland from Core Peptides can incorporate this peptide into their studies on GHRH receptor signaling, somatotroph function, growth hormone physiology, and endocrine research.

Sermorelin Research Areas

Research Area	Description
GHRH Receptor Pharmacology	Investigating Sermorelin’s binding affinity and selectivity for the GHRH receptor
Somatotroph Function	Studying Sermorelin’s effects on GH synthesis and secretion in pituitary cells
cAMP/PKA Signaling	Examining Sermorelin’s activation of adenylyl cyclase and downstream CREB-mediated transcription
Growth Hormone Physiology	Exploring Sermorelin’s role in pulsatile GH secretion and the hypothalamic-pituitary-somatotroph axis
Endocrine Research	Investigating Sermorelin’s effects on the GH/IGF-1 axis and metabolic regulation
Diagnostic Agent Studies	Preclinical research into Sermorelin’s utility in GH deficiency assessment
Receptor Binding Studies	Investigating the molecular basis of GHRH receptor-ligand interactions
Structure-Activity Relationships	Examining the pharmacophore requirements for GHRH receptor activation

Scientific Research on Sermorelin

Researchers have conducted extensive scientific studies on Sermorelin in both in vitro and in vivo settings, deriving evidence from cell cultures, preclinical models, and clinical research. The peptide has an extensive research history spanning over four decades in growth hormone physiology.

In Vitro Evidence

In vitro studies using pituitary cell cultures have demonstrated that Sermorelin binds to the GHRH receptor on somatotroph cells, activating Gs-protein-coupled adenylyl cyclase and increasing intracellular cAMP concentrations. This signaling cascade plays a well-established role in the synthesis and secretion of growth hormone (GH) in a pulsatile manner.

Furthermore, research has shown that Sermorelin, as the N-terminal 29-amino acid fragment of GHRH, retains the full biological activity of the native 44-amino acid hormone. The potency of Sermorelin equals that of the naturally occurring GHRH(1-40) and GHRH(1-44) isoforms.

Preclinical Studies

In animal models, researchers have investigated Sermorelin’s effects on growth hormone secretion and pituitary function. For instance, studies have examined the GH response to GHRH and Sermorelin in various experimental settings. Researchers have studied the peptide in contexts including growth hormone deficiency, age-related GH decline, and endocrine research.

Additionally, research has explored Sermorelin’s metabolic stability and degradation profile. Studies have demonstrated that Sermorelin and its metabolite rapidly degrade at temperatures above 4°C and pH values below 7, highlighting the importance of proper storage and handling in laboratory settings.

Human Research

Researchers have studied Sermorelin in human clinical research, and it has been licensed as a diagnostic test for growth hormone secretion. It has also been used in the treatment of growth hormone deficiency in children. However, products containing Sermorelin were withdrawn from the United States market by the manufacturer in November 2002.

Researchers have also investigated the peptide in the context of adult-onset growth hormone insufficiency and have explored it for age-related GH decline. Studies on treatment with GH secretagogues or GHRH for periods ranging from 20 weeks to 12 months have not reported significant side effects.

Nevertheless, researchers should note that Sermorelin is supplied for laboratory research purposes only. Scientists who buy Sermorelin in Switzerland should remain aware of these evidence considerations.

Sermorelin Compared With Related Peptides

Peptide	Relationship to Sermorelin	Key Differences
Native GHRH (1-44)	Parent compound; Sermorelin is a truncated analog	Native GHRH has 44 amino acids; Sermorelin has 29 amino acids (N-terminal fragment) with equal biological potency
Tesamorelin	Both are GHRH analogs	Tesamorelin has C-terminal lipophilic modification for extended half-life; Sermorelin has shorter duration
CJC-1295	Both are GHRH analogs	CJC-1295 has drug affinity complex for extended half-life; Sermorelin is the native 29-amino acid fragment
Ipamorelin	Both studied for growth hormone research	Ipamorelin is a GHRP (ghrelin receptor agonist); Sermorelin is a GHRH receptor agonist (different mechanism)
Growth Hormone (GH)	Sermorelin stimulates endogenous GH secretion	GH is direct exogenous administration; Sermorelin stimulates natural pulsatile GH release

Research Applications

Researchers utilize Sermorelin in a variety of laboratory research applications, primarily in the fields of endocrinology, receptor pharmacology, and growth hormone physiology. Key research applications include:

• GHRH Receptor Studies: Investigating Sermorelin’s binding affinity and selectivity for the GHRH receptor
• Somatotroph Function Research: Studying Sermorelin’s effects on GH synthesis and secretion in pituitary cells
• cAMP/PKA Signaling Studies: Examining Sermorelin’s activation of adenylyl cyclase and downstream CREB-mediated transcription
• Growth Hormone Physiology Research: Exploring Sermorelin’s role in pulsatile GH secretion and the hypothalamic-pituitary-somatotroph axis
• Endocrine Research: Investigating Sermorelin’s effects on the GH/IGF-1 axis and metabolic regulation
• Diagnostic Agent Studies: Preclinical research into Sermorelin’s utility in GH deficiency assessment
• Receptor Binding Studies: Investigating the molecular basis of GHRH receptor-ligand interactions
• Structure-Activity Relationship Studies: Examining the pharmacophore requirements for GHRH receptor activation

Researchers who buy Sermorelin in Switzerland can incorporate this peptide into their experimental protocols across these diverse research areas.

Sermorelin Product Specifications

Specification	Detail
Product Name	Sermorelin
Amount	5mg
Form	Lyophilized powder
Sequence (One-Letter)	YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Sequence (Three-Letter)	Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Length	29 amino acids
Molecular Formula	C149H246N44O42S
Molecular Weight	Approximately 3,357.9 g/mol
CAS Number	86168-78-7
C-terminal Modification	Amidation (-NH2)
Source	Synthetic (GHRH analog)
Mechanism	GHRH receptor agonist; cAMP/PKA pathway activation; GH secretion stimulation
Research Category	Growth Hormone Peptides
Purity	≥98% (HPLC)
Storage	Store desiccated at -20°C, protected from light

How to Evaluate Sermorelin Quality

When sourcing Sermorelin for research purposes, researchers should consider several quality indicators. A reliable Sermorelin peptide supplier should provide:

• Identity Confirmation: Analytical verification that the peptide matches the expected 29-amino acid sequence (Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2) and molecular weight (approximately 3,357.9 g/mol)
• Purity Analysis: Documentation of purity through methods such as RP-HPLC – research grade typically provides ≥98% purity
• Batch Information: Clear lot numbers and batch traceability
• Certificate of Analysis (CoA): Documentation of analytical testing results including MS (ESI) confirmation
• Proper Labeling: Accurate product identification and storage instructions
• Appearance: White to off-white lyophilized powder

Researchers looking to buy Sermorelin in Switzerland should seek suppliers who provide comprehensive documentation and quality assurance. Core Peptides remains committed to supporting research with properly documented products.

Understanding the Certificate of Analysis

A Certificate of Analysis (CoA) provides analytical data for a specific batch of a research peptide. For Sermorelin research, a CoA typically includes:

• Identity Confirmation: Mass spectrometry (ESI-MS or MALDI-TOF) confirming the peptide’s identity
• Purity Assessment: RP-HPLC chromatograms showing the purity of the peptide
• Amino Acid Analysis: Confirmation of amino acid composition following acid hydrolysis
• Water Content: Karl Fischer titration results
• Endotoxin Testing: LAL method results confirming low endotoxin levels
• Batch/Lot Information: Unique identifiers for traceability

Importantly, researchers should understand that a CoA demonstrates the chemical identity and purity of a peptide but does not establish safety, efficacy, therapeutic effectiveness, or suitability for human use. The CoA serves as a quality control document for research purposes only.

Storage and Stability

Proper storage of research peptides is essential for maintaining their integrity and stability. For Sermorelin, researchers should refer to the product documentation provided with their order for specific storage recommendations.

General best practices for Sermorelin storage include:

• Lyophilized powder: Store at -20°C ± 5°C, protected from light and moisture
• Reconstituted solution: Short-term storage at 2-8°C for up to 7 days; long-term storage at -20°C for up to 30 days
• Avoid repeated freeze-thaw cycles: Aliquot reconstituted peptide to prevent degradation
• Cold chain shipping: Ship at 2-8°C; dry ice recommended for extended transit

Studies have shown that Sermorelin and its metabolite rapidly degrade at temperatures above 4°C and pH values below 7, highlighting the importance of proper cold storage and appropriate reconstitution buffers.

For specific temperature requirements and reconstitution protocols, consult the applicable product documentation or contact Core Peptides for the applicable storage specifications.

Research Considerations

Researchers incorporating Sermorelin into their studies should be aware of several important considerations:

• Clinical Status: Sermorelin has been studied in human clinical research and licensed as a diagnostic test for GH secretion. However, products containing Sermorelin were withdrawn from the US market in 2002. The peptide is supplied for laboratory research purposes only.
• Experimental Status: Researchers consider Sermorelin a well-characterized compound, but findings should be interpreted within the context of ongoing research.
• Model Differences: Results from cell cultures and animal models may not translate directly to human outcomes.
• Regulatory Status: Sermorelin is not FDA-approved for therapeutic use and is intended for laboratory research use only.
• Quality Considerations: Researchers should verify the quality and identity of their Sermorelin through appropriate analytical methods.
• Mechanistic Context: Sermorelin’s proposed mechanisms involve GHRH receptor binding, Gs-protein activation, cAMP/PKA signaling, and CREB-mediated transcription. Researchers should consider appropriate experimental approaches to investigate these pathways.
• Stability Considerations: Sermorelin is sensitive to temperature and pH. Proper storage and handling are essential for maintaining peptide integrity.

Researchers who buy Sermorelin in Switzerland should ensure their studies include appropriate controls and interpret findings with scientific rigor.

Frequently Asked Questions About Sermorelin

What is Sermorelin?

Sermorelin is a synthetic 29-amino acid peptide corresponding to the N-terminal fragment of endogenous growth hormone-releasing hormone (GHRH(1-29)), with the sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2.

What is Sermorelin researched for?

Researchers primarily investigate Sermorelin for its binding to the GHRH receptor, activation of the cAMP/PKA signaling pathway, stimulation of growth hormone synthesis and secretion, and its role in somatotroph function and growth hormone physiology.

What is the amino acid sequence of Sermorelin?

The amino acid sequence of Sermorelin is Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2.

What is the molecular weight of Sermorelin?

The molecular weight of Sermorelin is approximately 3,357.9 g/mol.

What is the CAS number for Sermorelin?

The CAS number for Sermorelin is 86168-78-7.

What is the mechanism of action for Sermorelin?

Sermorelin binds to the GHRH receptor on anterior pituitary somatotroph cells, activating Gs-protein-coupled adenylyl cyclase, increasing intracellular cAMP, activating PKA, and promoting CREB-mediated transcription of the growth hormone gene.

How does Sermorelin differ from native GHRH?

Native GHRH has 44 amino acids; Sermorelin is the N-terminal 29-amino acid fragment that retains full biological activity and equal potency.

Does Sermorelin preserve natural GH pulsatility?

Yes, unlike direct GH administration, Sermorelin stimulates the body’s own pituitary gland to produce and secrete GH, preserving the natural pulsatile release pattern.

Is Sermorelin FDA-approved?

Sermorelin is not currently FDA-approved for therapeutic use. Products containing Sermorelin were withdrawn from the US market in 2002. It is intended for laboratory research use only.

Can I buy Sermorelin in Switzerland?

Yes, researchers can buy Sermorelin in Switzerland from Core Peptides for laboratory research purposes.

What is the primary research category for Sermorelin?

Sermorelin belongs to the Growth Hormone Peptides category, with secondary relevance to Cellular Research & Signaling research.

What related peptides are studied alongside Sermorelin?

Related peptides include native GHRH, Tesamorelin, CJC-1295, Ipamorelin, and Growth Hormone.

What is the purity of Core Peptides’ Sermorelin?

Core Peptides provides Sermorelin with a purity of ≥98% as verified by HPLC analysis.

How should Sermorelin be stored?

Sermorelin should be stored lyophilized, desiccated, protected from light, at -20°C. Reconstituted solutions should be stored at 2-8°C for up to 7 days or -20°C for up to 30 days.

Is Sermorelin sensitive to temperature?

Yes, studies have shown that Sermorelin and its metabolite rapidly degrade at temperatures above 4°C and pH values below 7.

Related Research Peptides

Researchers interested in Sermorelin may also find the following related peptides relevant to their work:

• Growth Hormone – The downstream hormone regulated by GHRH signaling, studied for growth and metabolic research
• CJC-1295 – A GHRH analog with drug affinity complex for extended half-life studies
• Tesamorelin – A GHRH analog with C-terminal lipophilic modification for enhanced stability
• Ipamorelin – A GHRP (ghrelin receptor agonist) studied for growth hormone research
• PEG-MGF – A PEGylated mechano growth factor studied for muscle and tissue repair

For a comprehensive selection of research peptides in Switzerland, explore the Core Peptides catalog.

Explore Growth Hormone Peptides

Sermorelin is part of our Growth Hormone Peptides category, which features a range of research peptides investigated for their effects on growth hormone physiology, pituitary function, and endocrine research. Browse our selection to find the right peptides for your laboratory research.

Explore Related Research Categories

Researchers may also find the following related categories relevant to Sermorelin research:

• Cellular Research & Signaling – Peptides studied for receptor signaling and GPCR pathways
• Anti-Aging & Longevity – Peptides investigated for age-related endocrine research applications
• Muscle & Performance Peptides – Peptides studied for muscle function and performance research

Further Research

Researchers interested in learning more about Sermorelin and related peptides should consult the primary scientific literature. Key areas of investigation include GHRH receptor biology, cAMP/PKA signaling, somatotroph function, and growth hormone physiology. The PubMed database is an excellent resource for accessing peer-reviewed research articles on these topics.

Research Disclaimer

Core Peptides supplies Sermorelin as a research peptide for laboratory research purposes only. It is not approved for human consumption, therapeutic use, or medical treatment. All information provided is for educational and scientific reference purposes only and does not constitute medical advice. Researchers are responsible for ensuring compliance with all applicable laws and regulations governing the use of research peptides in their jurisdiction, including Switzerland.