Sermorelin & GHRP-6 & GHRP-2 Blend (9MG)

What Is the Sermorelin & GHRP-6 & GHRP-2 Blend?

The Sermorelin & GHRP-6 & GHRP-2 Blend is a 9mg research peptide formulation combining three complementary growth hormone secretagogues: Sermorelin (3mg), a synthetic 29-amino acid GHRH analog corresponding to the biologically active N-terminal fragment of endogenous growth hormone-releasing hormone (GHRH 1-29); GHRP-6 (3mg), a potent synthetic hexapeptide ghrelin receptor agonist; and GHRP-2 (3mg, pralmorelin), a highly potent synthetic hexapeptide ghrelin receptor agonist. For those looking to buy Sermorelin & GHRP-6 & GHRP-2 Blend in Switzerland, Core Peptides offers high-quality research-grade material for laboratory applications.

This triple blend pairs a GHRH analogue with two ghrelin receptor agonists, studied for synergistic amplification of growth hormone release through dual pituitary receptor pathway activation. The rationale for combining these three peptides is rooted in research demonstrating that GHRH and ghrelin-pathway agonists activate distinct intracellular mechanisms that converge on somatotroph GH release, producing a response greater than the additive effects of any agent alone.

Research Overview

The Sermorelin & GHRP-6 & GHRP-2 Blend has attracted research interest as a triple-pathway approach to investigating growth hormone axis physiology. Sermorelin, the shortest functional GHRH analog containing the first 29 amino acids of endogenous GHRH, retains full affinity for GHRH receptors on pituitary cells. Meanwhile, GHRP-6 and GHRP-2 are fully synthetic peptides that function as growth hormone secretagogues (GHSs) by interacting with the growth hormone secretagogue receptor type 1a (GHS-R1a), also known as the ghrelin receptor.

Research interest in this blend centers on the synergistic interaction between these pathways. Studies have demonstrated that co-administration of GHRH with GHRPs produces significant synergistic amplification of GH release. One study reported that combining GHRH with GHRP-2 produced a synergistic 54-fold increase in pulsatile GH secretion compared to baseline. This synergy has been consistently replicated across multiple species and experimental paradigms. Consequently, this triple blend has generated significant interest as a research tool for investigating growth hormone physiology, pituitary function, and the hypothalamic-pituitary-somatotroph axis.

When researchers choose to buy Sermorelin & GHRP-6 & GHRP-2 Blend in Switzerland for laboratory studies, they gain access to a compound that may help elucidate mechanisms of synergistic GH secretion, dual GPCR signaling convergence, and growth hormone regulation at the molecular level.

How Does the Triple Blend Work?

The Sermorelin & GHRP-6 & GHRP-2 Blend exerts its biological effects through simultaneous activation of two distinct pituitary receptor pathways that converge on somatotroph cells to amplify growth hormone release.

Sermorelin: GHRH Receptor Activation

Sermorelin mimics endogenous GHRH by binding to the GHRH receptor (GHRH-R) on anterior pituitary somatotrophs. This class B GPCR activates the Gs/adenylyl cyclase/cAMP/PKA cascade. PKA then phosphorylates L-type calcium channels and the CREB transcription factor. This simultaneously triggers acute GH release and stimulates GH gene transcription. Importantly, this preserves normal GH pulsatility and feedback regulation.

GHRP-6 and GHRP-2: Ghrelin Receptor Activation

GHRP-6 and GHRP-2 act as agonists of the ghrelin receptor, also known as the growth hormone secretagogue receptor (GHS-R1a). This Gq-coupled receptor activates phospholipase C (PLC), which cleaves PIP₂ into IP₃ and DAG. IP₃ mobilizes endoplasmic reticulum calcium stores, releasing Ca²⁺ into the cytoplasm. Meanwhile, DAG activates protein kinase C (PKC), which interacts with protein synthesis related to GH synthesis.

GHRP-2 is the more potent of the two GHRPs, with 2-3 times the GH-releasing activity of GHRP-6 per unit dose. GHRP-6, however, is known for its additional effects on appetite stimulation through central ghrelin pathways.

Synergistic Amplification

The triple blend exploits dual signaling convergence on somatotroph calcium levels. Sermorelin-mediated cAMP/PKA signaling sensitizes voltage-gated calcium channels. At the same time, GHRP-mediated IP₃/PKC signaling mobilizes intracellular calcium. The combined calcium signal produces GH exocytosis significantly greater than either pathway alone.

When administered together, these peptides stimulate the pituitary gland through multiple pathways, resulting in a significantly amplified and more sustained release of growth hormone compared to any single peptide alone. Importantly, this triple mechanism preserves the physiological pulsatile pattern of GH release and maintains negative feedback via IGF-1 and somatostatin, distinguishing it from exogenous GH administration.

Researchers who buy Sermorelin & GHRP-6 & GHRP-2 Blend in Switzerland for research purposes can investigate these mechanisms across diverse experimental models of growth hormone physiology and pituitary function.

Why Is This Triple Blend Studied?

Researchers study the Sermorelin & GHRP-6 & GHRP-2 Blend primarily for its potential relevance to growth hormone physiology, pituitary function, and the hypothalamic-pituitary-somatotroph axis. The synergistic amplification of GH release through complementary pathways makes it a valuable tool for understanding the molecular basis of GH regulation.

Research has explored the use of GHRH analogues combined with GH secretagogues for investigating age-related GH decline. Sermorelin has been described as a physiologically appropriate approach to studying adult-onset GH insufficiency, as it maintains feedback regulation unlike exogenous GH. The addition of both GHRP-6 and GHRP-2 to this approach aims to further amplify the GH response through dual ghrelin receptor activation.

Moreover, researchers study this blend in the context of the natural feedback architecture of the hypothalamic-pituitary-somatotroph axis. In research models, this combination preserves sensitivity to somatostatin-mediated inhibition. Therefore, it offers a more physiologically relevant approach to investigating growth hormone regulation compared to direct GH administration.

Researchers who buy Sermorelin & GHRP-6 & GHRP-2 Blend in Switzerland from Core Peptides can incorporate this peptide into their studies on GHRH receptor signaling, ghrelin receptor pharmacology, somatotroph function, and growth hormone physiology.

Research Areas

Research Area	Description
Synergistic GH Release	Investigating the combined effects of GHRH, GHRP-6, and GHRP-2 on GH secretion
GHRH Receptor Pharmacology	Studying Sermorelin’s binding and activation of GHRH-R on somatotrophs
Ghrelin Receptor (GHS-R1a) Studies	Examining GHRP-6 and GHRP-2 activation of the ghrelin receptor
cAMP/PKA Signaling	Investigating the cAMP pathway activated by Sermorelin
PLC/IP3/DAG Pathway	Exploring the phospholipase C pathway activated by GHRPs
Somatotroph Function	Studying the effects of triple pathway activation on pituitary somatotroph cells
Growth Hormone Physiology	Exploring pulsatile GH secretion and the hypothalamic-pituitary-somatotroph axis
Appetite and Metabolism Research	Investigating GHRP-6’s effects on appetite through central ghrelin pathways

Scientific Research

Researchers have conducted scientific studies on Sermorelin, GHRP-6, GHRP-2, and their combinations in both in vitro and in vivo settings. They have derived evidence from cell cultures, preclinical models, and clinical research.

In Vitro Evidence

In vitro studies using pituitary cell cultures have demonstrated that Sermorelin binds to the GHRH receptor on somatotroph cells. This binding activates Gs-protein-coupled adenylyl cyclase and increases intracellular cAMP. Meanwhile, GHRP-2 and GHRP-6 act as agonists of the ghrelin receptor (GHS-R1a), activating phospholipase C and mobilizing intracellular calcium.

Research has shown that Sermorelin, as the N-terminal 29-amino acid fragment of GHRH, retains the full biological activity of the native 44-amino acid hormone. GHRP-2 is the most potent synthetic GHRP, with 2-3 times the GH-releasing activity of GHRP-6 per unit dose. However, combined GHRP-6 and GHRP-2 at maximal doses produce an additive effect on GH release.

Preclinical Studies

The foundational observation supporting GHRH/GHRP combination research comes from studies by Bowers and colleagues. These researchers demonstrated that simultaneous administration of GHRH and GHRPs produced GH responses significantly greater than either peptide alone. This synergy has been consistently replicated across multiple species and experimental paradigms.

In animal models, researchers have investigated the effects of Sermorelin, GHRP-6, and GHRP-2 on growth hormone secretion and pituitary function. Studies have shown that co-administration of GHRH with GHRP-2 produced a synergistic 54-fold increase in pulsatile GH secretion compared to baseline. Furthermore, GHRP-6 has demonstrated effects beyond GH release, including modulation of appetite and energy metabolism through central ghrelin pathways.

Human Research

Sermorelin has been studied in human clinical research and has been licensed as a diagnostic test for growth hormone secretion. Studies have reported that Sermorelin may increase mean 12-hour growth hormone concentrations approximately 2-fold.

GHRP-2 research suggests that under continuous 24-hour evaluation, the peptide may increase growth hormone production approximately 4- to 6-fold. Similarly, GHRP-6 has been shown to induce peak GH responses that exceed typical physiological peaks.

Nevertheless, researchers should note that this blend is supplied for laboratory research purposes only. Scientists who buy Sermorelin & GHRP-6 & GHRP-2 Blend in Switzerland should remain aware of these evidence considerations.

Compared With Related Peptides

Peptide/Blend	Relationship	Key Differences
Sermorelin Alone	Single component of the blend	Sermorelin alone activates only GHRH-R; the blend adds GHRP-6 and GHRP-2 for synergistic amplification
GHRP-6 Alone	Single component of the blend	GHRP-6 alone activates only GHS-R1a; the blend adds Sermorelin and GHRP-2
GHRP-2 Alone	Single component of the blend	GHRP-2 alone activates only GHS-R1a; GHRP-2 is more potent than GHRP-6 but has less appetite stimulation
Sermorelin & GHRP-2 Blend	Two-component blend	Dual blend lacks GHRP-6; triple blend adds GHRP-6 for additional appetite-related research applications
Growth Hormone (GH)	Blend stimulates endogenous GH	GH is direct exogenous administration; the blend stimulates natural pulsatile GH release

Research Applications

Researchers utilize the Sermorelin & GHRP-6 & GHRP-2 Blend in a variety of laboratory research applications, primarily in the fields of endocrinology, receptor pharmacology, and growth hormone physiology. Key research applications include:

• Synergistic GH Release Studies: Investigating the combined effects of GHRH, GHRP-6, and GHRP-2 on GH secretion
• GHRH Receptor Studies: Studying Sermorelin’s binding and activation of GHRH-R on somatotrophs
• Ghrelin Receptor (GHS-R1a) Studies: Examining GHRP-6 and GHRP-2 activation of the ghrelin receptor
• cAMP/PKA Signaling Research: Investigating the cAMP pathway activated by Sermorelin
• PLC/IP3/DAG Pathway Research: Exploring the phospholipase C pathway activated by GHRPs
• Somatotroph Function Studies: Studying the effects of triple pathway activation on pituitary somatotroph cells
• Growth Hormone Physiology Research: Exploring pulsatile GH secretion and the hypothalamic-pituitary-somatotroph axis
• Appetite and Metabolism Research: Investigating GHRP-6’s effects on appetite through central ghrelin pathways

Researchers who buy Sermorelin & GHRP-6 & GHRP-2 Blend in Switzerland can incorporate this peptide into their experimental protocols across these diverse research areas.

Product Specifications

Specification	Detail
Product Name	Sermorelin & GHRP-6 & GHRP-2 Blend
Total Amount	9mg
Contents	Sermorelin (3mg) & GHRP-6 (3mg) & GHRP-2 (3mg)
Form	Lyophilized powder
Sermorelin Sequence (One-Letter)	YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Sermorelin Molecular Formula	C149H246N44O42S
Sermorelin Molecular Weight	Approximately 3,357.9 g/mol
Sermorelin CAS Number	86168-78-7
GHRP-6 Sequence (One-Letter)	H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
GHRP-6 Molecular Formula	C46H56N12O6
GHRP-6 Molecular Weight	Approximately 873.01 g/mol
GHRP-6 CAS Number	87616-84-0
GHRP-2 Sequence (One-Letter)	D-Ala-D-2Nal-Ala-Trp-D-Phe-Lys-NH2
GHRP-2 Molecular Formula	C45H55N9O6
GHRP-2 Molecular Weight	Approximately 817.97 g/mol
GHRP-2 CAS Number	158861-67-7
GHRP-2 Synonyms	Pralmorelin, KP-102
Mechanism	GHRH receptor agonist (Sermorelin) + GHS-R1a agonists (GHRP-6, GHRP-2); synergistic GH release
Research Category	Growth Hormone Blends
Purity	>99% (HPLC)
Storage	Store desiccated at -20°C, protected from light

How to Evaluate Quality

When sourcing the Sermorelin & GHRP-6 & GHRP-2 Blend for research purposes, researchers should consider several quality indicators. A reliable Sermorelin & GHRP-6 & GHRP-2 Blend peptide supplier should provide:

• Identity Confirmation: Analytical verification that all three peptides match their expected sequences and molecular weights
• Purity Analysis: Documentation of purity through methods such as HPLC – research grade typically provides >99% purity
• Batch Information: Clear lot numbers and batch traceability
• Certificate of Analysis (CoA): Documentation of analytical testing results
• Proper Labeling: Accurate product identification and storage instructions
• Appearance: White to off-white lyophilized powder

Researchers looking to buy Sermorelin & GHRP-6 & GHRP-2 Blend in Switzerland should seek suppliers who provide comprehensive documentation and quality assurance. Core Peptides remains committed to supporting research with properly documented products.

Understanding the Certificate of Analysis

A Certificate of Analysis (CoA) provides analytical data for a specific batch of a research peptide. For Sermorelin & GHRP-6 & GHRP-2 Blend research, a CoA typically includes:

• Identity Confirmation: Mass spectrometry confirming all three peptides’ identities
• Purity Assessment: HPLC chromatograms showing the purity of each peptide
• Batch/Lot Information: Unique identifiers for traceability
• Analytical Methods: Description of the testing methods used

Importantly, researchers should understand that a CoA demonstrates the chemical identity and purity of a peptide but does not establish safety, efficacy, therapeutic effectiveness, or suitability for human use. The CoA serves as a quality control document for research purposes only.

Storage and Stability

Proper storage of research peptides is essential for maintaining their integrity and stability. For Sermorelin & GHRP-6 & GHRP-2 Blend, researchers should refer to the product documentation provided with their order for specific storage recommendations.

General best practices for peptide storage include keeping the lyophilized blend desiccated, protected from light, and stored at -20°C or below. For specific temperature requirements and reconstitution protocols, consult the applicable product documentation or contact Core Peptides for the applicable storage specifications.

Research Considerations

Researchers incorporating the Sermorelin & GHRP-6 & GHRP-2 Blend into their studies should be aware of several important considerations:

• Clinical Status: Sermorelin has been studied in human clinical research and licensed as a diagnostic test for GH secretion. GHRP-2 and GHRP-6 have been studied as provocative agents for GH testing. However, the blend is supplied for laboratory research purposes only.
• Experimental Status: Researchers consider the blend a well-characterized combination, but findings should be interpreted within the context of ongoing research.
• Model Differences: Results from cell cultures and animal models may not translate directly to human outcomes.
• Regulatory Status: All components are not FDA-approved and are intended for laboratory research use only.
• Quality Considerations: Researchers should verify the quality and identity of their blend through appropriate analytical methods.
• Mechanistic Context: The blend’s proposed mechanisms involve GHRH receptor activation, ghrelin receptor activation, and synergistic signaling convergence. Researchers should consider appropriate experimental approaches to investigate these pathways.
• Synergy Documentation: The synergistic effect of combining GHRH and GHRPs has been well-documented in the literature.

Researchers who buy Sermorelin & GHRP-6 & GHRP-2 Blend in Switzerland should ensure their studies include appropriate controls and interpret findings with scientific rigor.

Frequently Asked Questions

What is the Sermorelin & GHRP-6 & GHRP-2 Blend?

The Sermorelin & GHRP-6 & GHRP-2 Blend is a 9mg research peptide combination containing Sermorelin (3mg), a synthetic GHRH(1-29) analog; GHRP-6 (3mg), a potent ghrelin receptor agonist; and GHRP-2 (3mg, pralmorelin), a highly potent ghrelin receptor agonist.

What is this blend researched for?

Researchers primarily investigate this blend for synergistic amplification of growth hormone release through dual pituitary receptor pathway activation.

What is the mechanism of action?

Sermorelin activates GHRH receptors via the cAMP/PKA cascade, while GHRP-6 and GHRP-2 target GHS-R1a via the PLC/IP3/DAG pathway. Together, they produce synergistic GH release greater than any peptide alone.

What is the molecular weight of each component?

Sermorelin has a molecular weight of approximately 3,357.9 g/mol. GHRP-6 has a molecular weight of approximately 873.01 g/mol. GHRP-2 has a molecular weight of approximately 817.97 g/mol.

What are the CAS numbers?

Sermorelin CAS: 86168-78-7. GHRP-6 CAS: 87616-84-0. GHRP-2 CAS: 158861-67-7.

Is this blend FDA-approved?

This blend is not FDA-approved. It is intended for laboratory research use only and is not approved for human consumption or therapeutic use.

Can I buy the Sermorelin & GHRP-6 & GHRP-2 Blend in Switzerland?

Yes, researchers can buy Sermorelin & GHRP-6 & GHRP-2 Blend in Switzerland from Core Peptides for laboratory research purposes.

What is the primary research category for this blend?

This blend belongs to the Growth Hormone Blends category, with secondary relevance to Cellular Research & Signaling.

What related peptides are studied alongside this blend?

Related peptides include Sermorelin alone, GHRP-6 alone, GHRP-2 alone, CJC-1295, Ipamorelin, and other growth hormone secretagogues.

What is the purity of Core Peptides’ blend?

Core Peptides provides this blend with a purity of >99% as verified by HPLC analysis.

How should the blend be stored?

The blend should be stored lyophilized, desiccated, protected from light, at -20°C or below.

Does this blend preserve natural GH pulsatility?

Yes, unlike direct GH administration, this blend stimulates the pituitary to produce and secrete GH, preserving the natural pulsatile release pattern and maintaining negative feedback.

Related Research Peptides

Researchers interested in the Sermorelin & GHRP-6 & GHRP-2 Blend may also find the following related peptides relevant to their work:

• Sermorelin – The GHRH analog component, studied for GHRH receptor research
• GHRP-6 – The ghrelin receptor agonist component, studied for GHS-R1a and appetite research
• GHRP-2 – The ghrelin receptor agonist component, studied for GHS-R1a research with higher potency
• CJC-1295 – A long-acting GHRH analog with Drug Affinity Complex for extended half-life studies
• Ipamorelin – A GHRP studied for growth hormone research with different potency profile

For a comprehensive selection of research peptides in Switzerland, explore the Core Peptides catalog.

Explore Growth Hormone Blends

The Sermorelin & GHRP-6 & GHRP-2 Blend is part of our Growth Hormone Blends category, which features pre-mixed combinations of research peptides for growth hormone axis studies. Browse our selection to find the right peptides for your laboratory research.

Explore Related Research Categories

Researchers may also find the following related categories relevant to this blend:

• Cellular Research & Signaling – Peptides studied for GPCR signaling and receptor pharmacology
• Growth Hormone Peptides – Individual peptides for growth hormone research
• Anti-Aging & Longevity – Peptides investigated for age-related endocrine research

Further Research

Researchers interested in learning more about the Sermorelin & GHRP-6 & GHRP-2 Blend and related peptides should consult the primary scientific literature. Key areas of investigation include GHRH receptor biology, ghrelin receptor pharmacology, synergistic GH release, and growth hormone physiology. The PubMed database is an excellent resource for accessing peer-reviewed research articles on these topics.

Research Disclaimer

Core Peptides supplies the Sermorelin & GHRP-6 & GHRP-2 Blend as a research peptide for laboratory research purposes only. All information provided is for educational and scientific reference purposes only and does not constitute medical advice. Researchers are responsible for ensuring compliance with all applicable laws and regulations governing the use of research peptides in their jurisdiction, including Switzerland.