{"id":2933,"date":"2026-08-26T01:21:06","date_gmt":"2026-08-26T00:21:06","guid":{"rendered":"https:\/\/officialcorepeptides.brandloom.net\/it\/?post_type=product&p=2933"},"modified":"2026-08-26T01:21:06","modified_gmt":"2026-08-26T00:21:06","slug":"buy-pnc-27-in-switzerland","status":"publish","type":"product","link":"https:\/\/officialcorepeptides.ch\/it\/product\/buy-pnc-27-in-switzerland\/","title":{"rendered":"PNC-27 (5MG)"},"content":{"rendered":"

What Is PNC-27?<\/h2>\n

PNC-27 is a synthetic 32-residue chimeric peptide designed for oncology and membrane biology research. The peptide contains two functional domains: an HDM-2 binding domain derived from the p53 tumor suppressor protein (residues 12-26) and a cell-penetrating peptide (CPP) leader sequence that facilitates cellular entry. The complete sequence of PNC-27 is PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG.<\/p>\n

Researchers developed PNC-27 as a membrane-active peptide that selectively induces lysis of cancer cell membranes. The peptide’s unique structure\u2014featuring three alpha-helical domains connected by loop structures that form an S-shape\u2014creates an amphipathic conformation where hydrophobic residues coalesce on one face while polar residues aggregate on the opposite face. For those looking to buy PNC-27 in Switzerland<\/strong>, Core Peptides offers high-quality research-grade material for laboratory applications.<\/p>\n

PNC-27 Research Overview<\/h2>\n

PNC-27 has attracted significant research interest as a selective anticancer peptide. Studies have demonstrated that PNC-27 kills many different endodermal solid tissue and hematopoietic cancer cells while having no effect on normal cells. The peptide’s selectivity stems from the unique expression of HDM-2 in cancer cell membranes\u2014a protein that normal cells express at either very low levels or not at all in their membranes.<\/p>\n

Research interest in PNC-27 centers on its ability to induce cancer cell death through a novel mechanism involving interaction with membrane-expressed HDM-2. Consequently, PNC-27 has generated significant interest as a research tool for investigating selective cancer cell targeting, membrane pore formation, and necrosis induction pathways.<\/p>\n

When researchers choose to buy PNC-27 in Switzerland<\/strong> for laboratory studies, they gain access to a compound that may help elucidate mechanisms of selective cancer cell lysis, HDM-2 biology, and membrane-active peptide research at the molecular level.<\/p>\n

How Does PNC-27 Work?<\/h2>\n

PNC-27 exerts its biological effects through a selective membranolysis mechanism targeting cancer cells. The peptide’s mechanism involves several interconnected steps.<\/p>\n

HDM-2 Binding and Targeting<\/h3>\n

PNC-27 binds to HDM-2 (Human Double Minute 2) protein expressed in the plasma membranes of cancer cells. The peptide contains the HDM-2 binding domain of p53 (residues 12-26), which allows it to specifically recognize and bind to membrane-associated HDM-2. This binding is highly selective for cancer cells because normal cells express either no or very low levels of HDM-2 in their membranes.<\/p>\n

Furthermore, PNC-27 co-localizes with membrane-expressed HDM-2, forming complexes that coalesce to form transmembrane pores. The peptide’s structure\u2014an amphipathic conformation with hydrophobic and polar faces\u2014facilitates its insertion into lipid bilayers.<\/p>\n

Transmembrane Pore Formation<\/h3>\n

Upon binding to HDM-2, PNC-27 induces the formation of pores in the cancer cell membrane. These transmembrane pores disrupt the integrity of the cancer cell membrane, leading to uncontrolled ion flux and cellular contents leakage.<\/p>\n

Cancer Cell Necrosis<\/h3>\n

The pore formation ultimately leads to tumor cell lysis and necrosis. PNC-27 induces cancer cell death through necrosis rather than apoptosis, representing a distinct cell death pathway that may overcome certain resistance mechanisms.<\/p>\n

Additionally, recent research has shown that PNC-27 also interacts with mitochondrial membranes, causing mitochondrial disruption. This dual mechanism\u2014targeting both plasma membrane and mitochondrial membranes\u2014may contribute to the peptide’s potent anticancer activity.<\/p>\n

Researchers who buy PNC-27 in Switzerland<\/strong> for research purposes can investigate these mechanisms across diverse experimental models of oncology and membrane biology.<\/p>\n

Why Is PNC-27 Studied?<\/h2>\n

Researchers study PNC-27 primarily for its potential relevance to oncology, membrane biology, and selective cancer cell targeting. The peptide’s ability to selectively kill cancer cells while sparing normal cells makes it a valuable tool for understanding the molecular basis of cancer cell vulnerability and membrane-active peptide mechanisms.<\/p>\n

The peptide’s connection to the p53 tumor suppressor pathway and HDM-2 biology has made it a focus of cancer research. Preclinical studies have explored PNC-27’s effects on various cancer cell types, including cervical squamous cancer, acute myeloid leukemia, breast cancer, ovarian cancer, and pancreatic cancer.<\/p>\n

Moreover, researchers study PNC-27 in the context of treatment-resistant cancers and novel therapeutic approaches. The peptide’s unique mechanism\u2014inducing necrosis through membrane pore formation\u2014distinguishes it from conventional apoptosis-inducing agents and may offer insights into alternative cell death pathways.<\/p>\n

Researchers who buy PNC-27 in Switzerland<\/strong> from Core Peptides can incorporate this peptide into their studies on oncology, membrane biology, selective cell death, and HDM-2 targeting.<\/p>\n

PNC-27 Research Areas<\/h2>\n\n\n\n\n\n\n\n\n\n\n\n\n
Research Area<\/th>\nDescription<\/th>\n<\/tr>\n<\/thead>\n
Oncology Research<\/strong><\/td>\nInvestigating PNC-27’s selective anticancer activity against various tumor types<\/td>\n<\/tr>\n
HDM-2 Targeting<\/strong><\/td>\nStudying PNC-27’s binding to membrane-expressed HDM-2 in cancer cells<\/td>\n<\/tr>\n
Membrane Pore Formation<\/strong><\/td>\nExamining PNC-27’s induction of transmembrane pores in cancer cell membranes<\/td>\n<\/tr>\n
Cancer Cell Necrosis<\/strong><\/td>\nExploring PNC-27’s induction of tumor cell necrosis and cell death pathways<\/td>\n<\/tr>\n
Mitochondrial Disruption<\/strong><\/td>\nInvestigating PNC-27’s interaction with mitochondrial membranes<\/td>\n<\/tr>\n
Acute Myeloid Leukemia<\/strong><\/td>\nPreclinical research into PNC-27’s activity against AML cells<\/td>\n<\/tr>\n
Cervical Cancer Research<\/strong><\/td>\nStudying PNC-27’s effects on cervical squamous cancer cells<\/td>\n<\/tr>\n
Solid Tumor Research<\/strong><\/td>\nExploring PNC-27’s activity against endodermal solid tissue tumors<\/td>\n<\/tr>\n<\/tbody>\n<\/table>\n

Scientific Research on PNC-27<\/h2>\n

Researchers have conducted scientific studies on PNC-27 in both in vitro and preclinical settings, deriving evidence from cell cultures and various cancer cell lines. The peptide originates from research on the p53 tumor suppressor protein and its interaction with HDM-2\/MDM2.<\/p>\n

In Vitro Evidence<\/h3>\n

In vitro studies have demonstrated that PNC-27 kills many different endodermal solid tissue and hematopoietic cancer cells while having no effect on normal cells. The peptide’s selectivity stems from the unique expression of HDM-2 in cancer cell membranes\u2014normal cells express either no or very low levels of this protein in their membranes.<\/p>\n

Research has shown that PNC-27 binds to HDM-2 in a p53 peptide-like structure, inducing selective membrane-pore formation and leading to cancer cell lysis. The peptide’s mechanism involves co-localization with membrane-expressed HDM-2, inducing transmembrane pore formation and cancer cell necrosis.<\/p>\n

Furthermore, recent studies have demonstrated that PNC-27 also interacts with mitochondrial membranes, causing mitochondrial disruption. This dual mechanism\u2014targeting both plasma membrane and mitochondrial membranes\u2014may contribute to the peptide’s potent anticancer activity.<\/p>\n

Structural Studies<\/h3>\n

Researchers have characterized PNC-27’s structure using two-dimensional NMR spectroscopy. In an aqueous milieu, PNC-27 contains three alpha-helical domains connected by loop structures, forming an S-shape. The peptide forms amphipathic structures such that hydrophobic residues coalesce on one face while polar residues aggregate on the opposite face.<\/p>\n

This amphipathic conformation is critical for the peptide’s membrane-active properties, enabling it to insert into lipid bilayers and form transmembrane pores.<\/p>\n

Preclinical Studies<\/h3>\n

PNC-27 has been investigated in various cancer models. Studies have demonstrated its activity against cervical squamous cancer cells and acute myeloid leukemia cells. Research has also explored its effects on breast cancer, ovarian cancer, and pancreatic cancer cells.<\/p>\n

A 2014 study demonstrated that PNC-27 induces tumor cell necrosis in a poorly differentiated non-solid tissue human leukemia cell line that depends on expression of HDM-2 in the plasma membrane.<\/p>\n

Human Research<\/h3>\n

PNC-27 has limited human clinical evidence. As of April 2026, the peptide remains primarily a research tool for preclinical oncology studies. PNC-27 is not FDA-approved for any indication and is classified as a research-use-only compound. Scientists who buy PNC-27 in Switzerland<\/strong> should remain aware of these evidence considerations.<\/p>\n

PNC-27 Compared With Related Peptides<\/h2>\n\n\n\n\n\n\n\n\n\n
Peptide<\/th>\nRelationship to PNC-27<\/th>\nKey Differences<\/th>\n<\/tr>\n<\/thead>\n
PNC-28<\/strong><\/td>\nAnalogous peptide with similar mechanism<\/td>\nPNC-28 has a different p53 leader sequence configuration; both induce cancer cell death via HDM-2 interaction<\/td>\n<\/tr>\n
p53 Peptides<\/strong><\/td>\nPNC-27 contains the p53 HDM-2 binding domain<\/td>\nPNC-27 is a chimeric peptide with CPP domain; native p53 peptides lack membrane-penetrating properties<\/td>\n<\/tr>\n
Penetratin<\/strong><\/td>\nPNC-27 incorporates a penetratin-like CPP domain<\/td>\nPenetratin is a cell-penetrating peptide without anticancer activity; PNC-27 combines CPP with HDM-2 targeting<\/td>\n<\/tr>\n
Membrane-Active Peptides<\/strong><\/td>\nPNC-27 is a membrane-active peptide<\/td>\nPNC-27 demonstrates selective cancer cell targeting via HDM-2; other membrane-active peptides may lack selectivity<\/td>\n<\/tr>\n
HDM-2 Inhibitors<\/strong><\/td>\nBoth target HDM-2<\/td>\nPNC-27 targets membrane-bound HDM-2; other HDM-2 inhibitors typically target intracellular interactions<\/td>\n<\/tr>\n<\/tbody>\n<\/table>\n

Research Applications<\/h2>\n

Researchers utilize PNC-27 in a variety of laboratory research applications, primarily in the fields of oncology, membrane biology, and cell death research. Key research applications include:<\/p>\n