PNC-27 (5MG)

What Is PNC-27?

PNC-27 is a synthetic 32-residue chimeric peptide designed for oncology and membrane biology research. The peptide contains two functional domains: an HDM-2 binding domain derived from the p53 tumor suppressor protein (residues 12-26) and a cell-penetrating peptide (CPP) leader sequence that facilitates cellular entry. The complete sequence of PNC-27 is PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG.

Researchers developed PNC-27 as a membrane-active peptide that selectively induces lysis of cancer cell membranes. The peptide’s unique structure—featuring three alpha-helical domains connected by loop structures that form an S-shape—creates an amphipathic conformation where hydrophobic residues coalesce on one face while polar residues aggregate on the opposite face. For those looking to buy PNC-27 in Switzerland, Core Peptides offers high-quality research-grade material for laboratory applications.

PNC-27 Research Overview

PNC-27 has attracted significant research interest as a selective anticancer peptide. Studies have demonstrated that PNC-27 kills many different endodermal solid tissue and hematopoietic cancer cells while having no effect on normal cells. The peptide’s selectivity stems from the unique expression of HDM-2 in cancer cell membranes—a protein that normal cells express at either very low levels or not at all in their membranes.

Research interest in PNC-27 centers on its ability to induce cancer cell death through a novel mechanism involving interaction with membrane-expressed HDM-2. Consequently, PNC-27 has generated significant interest as a research tool for investigating selective cancer cell targeting, membrane pore formation, and necrosis induction pathways.

When researchers choose to buy PNC-27 in Switzerland for laboratory studies, they gain access to a compound that may help elucidate mechanisms of selective cancer cell lysis, HDM-2 biology, and membrane-active peptide research at the molecular level.

How Does PNC-27 Work?

PNC-27 exerts its biological effects through a selective membranolysis mechanism targeting cancer cells. The peptide’s mechanism involves several interconnected steps.

HDM-2 Binding and Targeting

PNC-27 binds to HDM-2 (Human Double Minute 2) protein expressed in the plasma membranes of cancer cells. The peptide contains the HDM-2 binding domain of p53 (residues 12-26), which allows it to specifically recognize and bind to membrane-associated HDM-2. This binding is highly selective for cancer cells because normal cells express either no or very low levels of HDM-2 in their membranes.

Furthermore, PNC-27 co-localizes with membrane-expressed HDM-2, forming complexes that coalesce to form transmembrane pores. The peptide’s structure—an amphipathic conformation with hydrophobic and polar faces—facilitates its insertion into lipid bilayers.

Transmembrane Pore Formation

Upon binding to HDM-2, PNC-27 induces the formation of pores in the cancer cell membrane. These transmembrane pores disrupt the integrity of the cancer cell membrane, leading to uncontrolled ion flux and cellular contents leakage.

Cancer Cell Necrosis

The pore formation ultimately leads to tumor cell lysis and necrosis. PNC-27 induces cancer cell death through necrosis rather than apoptosis, representing a distinct cell death pathway that may overcome certain resistance mechanisms.

Additionally, recent research has shown that PNC-27 also interacts with mitochondrial membranes, causing mitochondrial disruption. This dual mechanism—targeting both plasma membrane and mitochondrial membranes—may contribute to the peptide’s potent anticancer activity.

Researchers who buy PNC-27 in Switzerland for research purposes can investigate these mechanisms across diverse experimental models of oncology and membrane biology.

Why Is PNC-27 Studied?

Researchers study PNC-27 primarily for its potential relevance to oncology, membrane biology, and selective cancer cell targeting. The peptide’s ability to selectively kill cancer cells while sparing normal cells makes it a valuable tool for understanding the molecular basis of cancer cell vulnerability and membrane-active peptide mechanisms.

The peptide’s connection to the p53 tumor suppressor pathway and HDM-2 biology has made it a focus of cancer research. Preclinical studies have explored PNC-27’s effects on various cancer cell types, including cervical squamous cancer, acute myeloid leukemia, breast cancer, ovarian cancer, and pancreatic cancer.

Moreover, researchers study PNC-27 in the context of treatment-resistant cancers and novel therapeutic approaches. The peptide’s unique mechanism—inducing necrosis through membrane pore formation—distinguishes it from conventional apoptosis-inducing agents and may offer insights into alternative cell death pathways.

Researchers who buy PNC-27 in Switzerland from Core Peptides can incorporate this peptide into their studies on oncology, membrane biology, selective cell death, and HDM-2 targeting.

PNC-27 Research Areas

Research Area	Description
Oncology Research	Investigating PNC-27’s selective anticancer activity against various tumor types
HDM-2 Targeting	Studying PNC-27’s binding to membrane-expressed HDM-2 in cancer cells
Membrane Pore Formation	Examining PNC-27’s induction of transmembrane pores in cancer cell membranes
Cancer Cell Necrosis	Exploring PNC-27’s induction of tumor cell necrosis and cell death pathways
Mitochondrial Disruption	Investigating PNC-27’s interaction with mitochondrial membranes
Acute Myeloid Leukemia	Preclinical research into PNC-27’s activity against AML cells
Cervical Cancer Research	Studying PNC-27’s effects on cervical squamous cancer cells
Solid Tumor Research	Exploring PNC-27’s activity against endodermal solid tissue tumors

Scientific Research on PNC-27

Researchers have conducted scientific studies on PNC-27 in both in vitro and preclinical settings, deriving evidence from cell cultures and various cancer cell lines. The peptide originates from research on the p53 tumor suppressor protein and its interaction with HDM-2/MDM2.

In Vitro Evidence

In vitro studies have demonstrated that PNC-27 kills many different endodermal solid tissue and hematopoietic cancer cells while having no effect on normal cells. The peptide’s selectivity stems from the unique expression of HDM-2 in cancer cell membranes—normal cells express either no or very low levels of this protein in their membranes.

Research has shown that PNC-27 binds to HDM-2 in a p53 peptide-like structure, inducing selective membrane-pore formation and leading to cancer cell lysis. The peptide’s mechanism involves co-localization with membrane-expressed HDM-2, inducing transmembrane pore formation and cancer cell necrosis.

Furthermore, recent studies have demonstrated that PNC-27 also interacts with mitochondrial membranes, causing mitochondrial disruption. This dual mechanism—targeting both plasma membrane and mitochondrial membranes—may contribute to the peptide’s potent anticancer activity.

Structural Studies

Researchers have characterized PNC-27’s structure using two-dimensional NMR spectroscopy. In an aqueous milieu, PNC-27 contains three alpha-helical domains connected by loop structures, forming an S-shape. The peptide forms amphipathic structures such that hydrophobic residues coalesce on one face while polar residues aggregate on the opposite face.

This amphipathic conformation is critical for the peptide’s membrane-active properties, enabling it to insert into lipid bilayers and form transmembrane pores.

Preclinical Studies

PNC-27 has been investigated in various cancer models. Studies have demonstrated its activity against cervical squamous cancer cells and acute myeloid leukemia cells. Research has also explored its effects on breast cancer, ovarian cancer, and pancreatic cancer cells.

A 2014 study demonstrated that PNC-27 induces tumor cell necrosis in a poorly differentiated non-solid tissue human leukemia cell line that depends on expression of HDM-2 in the plasma membrane.

Human Research

PNC-27 has limited human clinical evidence. As of April 2026, the peptide remains primarily a research tool for preclinical oncology studies. PNC-27 is not FDA-approved for any indication and is classified as a research-use-only compound. Scientists who buy PNC-27 in Switzerland should remain aware of these evidence considerations.

PNC-27 Compared With Related Peptides

Peptide	Relationship to PNC-27	Key Differences
PNC-28	Analogous peptide with similar mechanism	PNC-28 has a different p53 leader sequence configuration; both induce cancer cell death via HDM-2 interaction
p53 Peptides	PNC-27 contains the p53 HDM-2 binding domain	PNC-27 is a chimeric peptide with CPP domain; native p53 peptides lack membrane-penetrating properties
Penetratin	PNC-27 incorporates a penetratin-like CPP domain	Penetratin is a cell-penetrating peptide without anticancer activity; PNC-27 combines CPP with HDM-2 targeting
Membrane-Active Peptides	PNC-27 is a membrane-active peptide	PNC-27 demonstrates selective cancer cell targeting via HDM-2; other membrane-active peptides may lack selectivity
HDM-2 Inhibitors	Both target HDM-2	PNC-27 targets membrane-bound HDM-2; other HDM-2 inhibitors typically target intracellular interactions

Research Applications

Researchers utilize PNC-27 in a variety of laboratory research applications, primarily in the fields of oncology, membrane biology, and cell death research. Key research applications include:

• Oncology Research: Investigating PNC-27’s selective anticancer activity against various tumor types
• HDM-2 Targeting Studies: Studying PNC-27’s binding to membrane-expressed HDM-2 in cancer cells
• Membrane Pore Formation Research: Examining PNC-27’s induction of transmembrane pores in cancer cell membranes
• Cancer Cell Necrosis Studies: Exploring PNC-27’s induction of tumor cell necrosis and cell death pathways
• Mitochondrial Disruption Research: Investigating PNC-27’s interaction with mitochondrial membranes
• Acute Myeloid Leukemia Research: Preclinical research into PNC-27’s activity against AML cells
• Cervical Cancer Research: Studying PNC-27’s effects on cervical squamous cancer cells
• Solid Tumor Research: Exploring PNC-27’s activity against endodermal solid tissue tumors

Researchers who buy PNC-27 in Switzerland can incorporate this peptide into their experimental protocols across these diverse research areas.

PNC-27 Product Specifications

Specification	Detail
Product Name	PNC-27
Amount	5mg
Form	Lyophilized powder
Sequence (One-Letter)	PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Length	32 amino acids
Molecular Formula	C188H293N53O44S
Molecular Weight	Approximately 4031.73 g/mol (free base)
CAS Number	1159861-00-3
Synonyms	PNC-27 peptide, p53-penetratin chimeric peptide
Domains	HDM-2 binding domain (p53 residues 12-26) + CPP leader sequence
Mechanism	HDM-2 binding; transmembrane pore formation; cancer cell necrosis
Research Category	Cellular Research & Signaling
Purity	Not provided
Storage	Refer to product documentation

How to Evaluate PNC-27 Quality

When sourcing PNC-27 for research purposes, researchers should consider several quality indicators. A reliable PNC-27 peptide supplier should provide:

• Identity Confirmation: Analytical verification that the peptide matches the expected 32-residue sequence (PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG) and molecular weight (approximately 4031.73 g/mol)
• Purity Analysis: Documentation of purity through methods such as HPLC (High-Performance Liquid Chromatography)
• Batch Information: Clear lot numbers and batch traceability
• Certificate of Analysis (CoA): Documentation of analytical testing results
• Proper Labeling: Accurate product identification and storage instructions
• Sequence Verification: Confirmation of the complete 32-amino-acid sequence, as this is critical for the peptide’s biological activity

Researchers looking to buy PNC-27 in Switzerland should seek suppliers who provide comprehensive documentation and quality assurance. Core Peptides remains committed to supporting research with properly documented products.

Understanding the Certificate of Analysis

A Certificate of Analysis (CoA) provides analytical data for a specific batch of a research peptide. For PNC-27 research, a CoA typically includes:

• Identity Confirmation: Mass spectrometry or other analytical methods confirming the peptide’s identity
• Purity Assessment: HPLC chromatograms showing the purity of the peptide
• Batch/Lot Information: Unique identifiers for traceability
• Analytical Methods: Description of the testing methods used

Importantly, researchers should understand that a CoA demonstrates the chemical identity and purity of a peptide but does not establish safety, efficacy, therapeutic effectiveness, or suitability for human use. The CoA serves as a quality control document for research purposes only.

Storage and Stability

Proper storage of research peptides is essential for maintaining their integrity and stability. For PNC-27, researchers should refer to the product documentation provided with their order for specific storage recommendations.

General best practices for peptide storage include keeping lyophilized peptides in a cool, dry environment, protected from light and moisture. For specific temperature requirements and reconstitution protocols, consult the applicable product documentation or contact Core Peptides for the applicable storage specifications.

Research Considerations

Researchers incorporating PNC-27 into their studies should be aware of several important considerations:

• Evidence Limitations: PNC-27 has limited human clinical evidence. As of April 2026, the peptide remains primarily a research tool for preclinical oncology studies. PNC-27 is not FDA-approved and is classified as a research-use-only compound.
• Experimental Status: Researchers consider PNC-27 an experimental compound. Therefore, findings should be interpreted within the context of early-stage research.
• Model Differences: Results from cell cultures and in vitro studies may not translate directly to complex biological outcomes.
• Regulatory Status: PNC-27 is not FDA-approved and is intended for laboratory research use only.
• Quality Considerations: Researchers should verify the quality and identity of their PNC-27 through appropriate analytical methods.
• Mechanistic Context: PNC-27’s proposed mechanism involves HDM-2 binding, membrane pore formation, and necrosis induction. Researchers should consider appropriate experimental approaches to investigate these pathways.
• Selectivity Considerations: PNC-27 demonstrates selectivity for cancer cells based on HDM-2 membrane expression. Researchers should consider this selectivity when designing experiments.

Researchers who buy PNC-27 in Switzerland should ensure their studies include appropriate controls and interpret findings with scientific rigor.

Frequently Asked Questions About PNC-27

What is PNC-27?

PNC-27 is a synthetic 32-residue chimeric peptide composed of an HDM-2 binding domain from the p53 tumor suppressor protein (residues 12-26) fused to a cell-penetrating peptide (CPP) leader sequence.

What is PNC-27 researched for?

Researchers primarily investigate PNC-27 for its selective anticancer activity, HDM-2 targeting, membrane pore formation, and induction of cancer cell necrosis.

What is the amino acid sequence of PNC-27?

The amino acid sequence of PNC-27 is PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG.

What is the molecular weight of PNC-27?

The molecular weight of PNC-27 is approximately 4031.73 g/mol (free base).

What is the CAS number for PNC-27?

The CAS number for PNC-27 is 1159861-00-3.

What is the mechanism of action for PNC-27?

PNC-27 binds to HDM-2 expressed in cancer cell membranes, inducing transmembrane pore formation and subsequent tumor cell lysis and necrosis.

Does PNC-27 affect normal cells?

PNC-27 kills cancer cells while having no effect on normal cells due to the unique expression of HDM-2 in cancer cell membranes.

What cancer types has PNC-27 been studied against?

PNC-27 has been studied against cervical squamous cancer, acute myeloid leukemia, breast cancer, ovarian cancer, and pancreatic cancer cells.

Does PNC-27 have human clinical evidence?

PNC-27 has limited human clinical evidence. As of April 2026, the peptide remains primarily a research tool for preclinical oncology studies.

Is PNC-27 FDA-approved?

PNC-27 is not FDA-approved. It is intended for laboratory research use only and is not approved for human consumption or therapeutic use.

Can I buy PNC-27 in Switzerland?

Yes, researchers can buy PNC-27 in Switzerland from Core Peptides for laboratory research purposes.

What is the primary research category for PNC-27?

PNC-27 belongs to the Cellular Research & Signaling category, with secondary relevance to Anti-Aging & Longevity research.

What related peptides are studied alongside PNC-27?

Related peptides include PNC-28, p53-derived peptides, penetratin, and other membrane-active anticancer peptides.

How should PNC-27 be stored?

Refer to the product documentation for specific storage recommendations. Peptides are generally stored lyophilized in cool, dry conditions.

What structural features characterize PNC-27?

PNC-27 contains three alpha-helical domains connected by loop structures forming an S-shape, creating an amphipathic conformation.

Related Research Peptides

Researchers interested in PNC-27 may also find the following related peptides relevant to their work:

• PNC-28 – An analogous peptide with similar HDM-2 targeting and anticancer mechanisms
• p53 Peptides – Peptides derived from the p53 tumor suppressor protein
• Penetratin – A cell-penetrating peptide used in delivery research
• BPC-157 – A peptide studied for healing and tissue repair
• GHK-Cu – A copper peptide studied for cellular research

For a comprehensive selection of research peptides in Switzerland, explore the Core Peptides catalog.

Explore Cellular Research & Signaling Peptides

PNC-27 is part of our Cellular Research & Signaling category, which features a range of research peptides investigated for their effects on cellular function, signaling pathways, and cell death mechanisms. Browse our selection to find the right peptides for your laboratory research.

Explore Related Research Categories

Researchers may also find the following related categories relevant to PNC-27 research:

• Anti-Aging & Longevity – Peptides investigated for age-related cellular research applications
• Cognitive & Nootropic Peptides – Peptides studied for neurological and cognitive research
• Healing & Regeneration Peptides – Peptides investigated for tissue repair and regeneration

Further Research

Researchers interested in learning more about PNC-27 and related peptides should consult the primary scientific literature. Key areas of investigation include HDM-2 biology, membrane pore formation, selective cancer cell targeting, and necrosis induction pathways. The PubMed database is an excellent resource for accessing peer-reviewed research articles on these topics.

Research Disclaimer

Core Peptides supplies PNC-27 as a research peptide for laboratory research purposes only. It is not approved for human consumption, therapeutic use, or medical treatment. All information provided is for educational and scientific reference purposes only and does not constitute medical advice. Researchers are responsible for ensuring compliance with all applicable laws and regulations governing the use of research peptides in their jurisdiction, including Switzerland.