{"id":2880,"date":"2026-08-25T12:11:16","date_gmt":"2026-08-25T11:11:16","guid":{"rendered":"https:\/\/officialcorepeptides.brandloom.net\/en\/?post_type=product&p=2880"},"modified":"2026-08-25T12:11:16","modified_gmt":"2026-08-25T11:11:16","slug":"buy-ll-37-5mg-in-switzerland","status":"publish","type":"product","link":"https:\/\/officialcorepeptides.ch\/en\/product\/buy-ll-37-5mg-in-switzerland\/","title":{"rendered":"LL-37 (5MG)80.10"},"content":{"rendered":"

What Is LL-37 and Why Buy It for Research?<\/strong><\/h2>\n

Buy LL-37 5mg in Switzerland for research into innate immunity, antimicrobial host defense, and immunomodulatory pathways. Specifically, LL-37 is a synthetic 37-amino acid peptide and the sole human cathelicidin identified to date[reference:0]. It is a proteolytic fragment derived from the C-terminal region of the 18-kDa human cathelicidin antimicrobial protein hCAP-18, which is expressed in epithelial cells, leukocytes, and various tissues throughout the body[reference:1][reference:2].<\/p>\n

The peptide has the sequence Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser ([LL-37, 37 aa])[reference:3]. LL-37 has a molecular weight of approximately 4,493 g\/mol and the molecular formula C\u2082\u2080\u2085H\u2083\u2084\u2080N\u2086\u2080O\u2085\u2083[reference:4]. The CAS number for LL-37 is 154947-66-7[reference:5][reference:6].<\/p>\n

In scientific research, LL-37 serves as a molecular tool for studying innate immune responses, antimicrobial mechanisms, inflammation regulation, and tissue repair pathways. Furthermore, Core Peptides supplies LL-37 as a lyophilized powder in a 5mg format exclusively for laboratory use. Therefore, researchers seeking to source this compound for their work will find it readily available when they buy LL-37 5mg in Switzerland.<\/p>\n

LL-37 Research Overview: Buy LL-37 5mg in Switzerland for Innate Immunity Studies<\/strong><\/h2>\n

Centrally, research into LL-37 has focused on its function as the sole human cathelicidin and a multifunctional host defense peptide with broad-spectrum antimicrobial and immunomodulatory properties[reference:7]. LL-37 is a 37-residue amphipathic peptide that adopts an alpha-helical conformation in membrane-mimetic environments, enabling it to interact with and disrupt microbial membranes[reference:8].<\/p>\n

LL-37 effectively combats over 38 bacteria, 16 fungi, and 16 viruses through various mechanisms, including membrane rupture, targeting, and biofilm suppression[reference:9]. These mechanisms involve cell wall destruction, membrane permeabilization, oxidative stress, cell cycle arrest, adhesion prevention, gene modification, and disruption of viral envelopes[reference:10]. The peptide exhibits potent activity against both Gram-positive and Gram-negative bacteria[reference:11].<\/p>\n

Beyond its direct antimicrobial effects, LL-37 plays numerous roles in inflammatory and tissue remodeling processes[reference:12]. The peptide stimulates angiogenesis, induces proliferation of lung epithelial cells, accelerates wound closure of the airway epithelium, and provokes cytokine release (e.g., IL-8) and cell migration[reference:13]. LL-37 also neutralizes lipopolysaccharide (LPS), a potent pro-inflammatory endotoxin produced by Gram-negative bacteria[reference:14]. Accordingly, researchers who buy LL-37 5mg in Switzerland from Core Peptides can support their investigations into innate immunity, antimicrobial mechanisms, and immunomodulatory pathways.<\/p>\n

How Does LL-37 Work in Research?<\/strong><\/h2>\n

Mechanistically, LL-37’s proposed action involves functioning as a multifunctional host defense peptide that exerts both direct antimicrobial effects and immunomodulatory activities through multiple signaling pathways. The peptide operates through several interconnected mechanisms.<\/p>\n

Membrane Disruption and Antimicrobial Activity<\/strong><\/h3>\n

LL-37 exerts direct antimicrobial activity against Gram-negative bacteria primarily via membrane disruption[reference:15]. The peptide forms toroidal pores in bacterial membranes, leading to cell lysis and death[reference:16]. LL-37 effectively combats over 38 bacteria, 16 fungi, and 16 viruses through mechanisms including membrane rupture, targeting, and biofilm suppression[reference:17]. Additionally, LL-37 prevents adhesion, modifies genes, and disrupts viral envelopes[reference:18].<\/p>\n

LPS Neutralization and Anti-Endotoxin Activity<\/strong><\/h3>\n

LL-37 neutralizes lipopolysaccharide (LPS), a potent pro-inflammatory endotoxin produced by Gram-negative bacteria[reference:19]. This LPS-neutralizing activity is critical for mitigating the inflammatory response associated with bacterial infections and endotoxemia. Studies have demonstrated that LL-37 protects animals against endotoxemia and sepsis[reference:20].<\/p>\n

Immunomodulation and Cytokine Regulation<\/strong><\/h3>\n

LL-37 modulates the innate immune response through multiple mechanisms. The peptide binds and inactivates bacterial endotoxins and promotes chemotaxis of immune cells[reference:21]. LL-37 interacts with plasma membrane receptors and mediates import of Ca\u00b2\u207a[reference:22]. The peptide also modulates TLR-mediated inflammatory responses[reference:23] and induces NET formation in innate immune cells[reference:24].<\/p>\n

Angiogenesis and Wound Healing<\/strong><\/h3>\n

LL-37 stimulates angiogenesis and promotes wound healing through multiple pathways[reference:25]. The peptide induces proliferation of epithelial cells, accelerates wound closure, and promotes tissue remodeling[reference:26]. LL-37 also upregulates VEGF-A and TGF-\u03b2 expression, accelerating the healing process in tissue injury models[reference:27].<\/p>\n

Why Is LL-37 Studied in Switzerland?<\/strong><\/h2>\n

Primarily, researchers study LL-37 because it represents the sole human cathelicidin antimicrobial peptide, enabling investigation of innate immunity, antimicrobial mechanisms, and immunomodulatory pathways[reference:28]. In fact, this compound offers a focused tool for studying the molecular mechanisms underlying host defense, inflammation regulation, and tissue repair.<\/p>\n

Research has demonstrated LL-37’s relevance across multiple domains. The host defense activity of LL-37 is underscored by its expression throughout the body, spanning from epithelial cells of various organs\u2014testis, skin, respiratory tract, and gastrointestinal tract\u2014to immune cells[reference:29]. LL-37 has garnered significant interest due to its potent antimicrobial, antiviral, antifungal, antiparasitic, and antitumor properties[reference:30].<\/p>\n

Furthermore, LL-37 has been studied for its therapeutic potential in chronic wounds, inflammatory bowel disease, periodontitis, and infectious diseases[reference:31]. The peptide’s ability to modulate cytokine responses and promote bacterial phagocytosis by immune cells underscores its immunomodulatory potential[reference:32]. Ultimately, researchers who buy LL-37 5mg in Switzerland gain access to a comprehensive research tool for investigating innate immunity, antimicrobial host defense, and immunomodulatory pathways.<\/p>\n

LL-37 Research Areas in Laboratory Studies<\/strong><\/h2>\n\n\n\n\n\n\n\n\n\n\n\n
Research Area<\/th>\nFocus<\/th>\nEvidence Level<\/th>\n<\/tr>\n<\/thead>\n
Antimicrobial Research<\/td>\nBroad-spectrum activity against bacteria, viruses, fungi; biofilm inhibition<\/td>\nMechanistic \/ In Vitro \/ In Vivo<\/td>\n<\/tr>\n
Immunomodulation<\/td>\nCytokine regulation, chemotaxis, TLR modulation, NETosis<\/td>\nMechanistic \/ In Vitro \/ In Vivo<\/td>\n<\/tr>\n
Wound Healing<\/td>\nEpithelial cell proliferation, angiogenesis, tissue remodeling<\/td>\nPreclinical<\/td>\n<\/tr>\n
Innate Immunity<\/td>\nHost defense, LPS neutralization, endotoxin clearance<\/td>\nMechanistic \/ In Vivo<\/td>\n<\/tr>\n
Inflammatory Diseases<\/td>\nIBD, periodontitis, respiratory diseases, sepsis<\/td>\nPreclinical<\/td>\n<\/tr>\n
Anti-Cancer Research<\/td>\nAnti-cancer properties, tumor microenvironment modulation<\/td>\nEmerging Research<\/td>\n<\/tr>\n
Anti-Amyloidogenic Research<\/td>\nAmyloid-related disease modulation, protein aggregation<\/td>\nEmerging Research<\/td>\n<\/tr>\n<\/tbody>\n<\/table>\n

LL-37 Compared With Related Research Compounds<\/strong><\/h2>\n\n\n\n\n\n\n\n\n
Compound<\/th>\nResearch Focus<\/th>\nMechanism \/ Target<\/th>\nKey Difference<\/th>\n<\/tr>\n<\/thead>\n
LL-37<\/td>\nAntimicrobial, immunomodulation, wound healing<\/td>\nMembrane disruption, LPS neutralization, receptor modulation<\/td>\nSole human cathelicidin; 37-amino acid; pleiotropic host defense<\/td>\n<\/tr>\n
BPC-157<\/td>\nTissue healing, gastrointestinal protection<\/td>\nGrowth factor modulation, angiogenesis<\/td>\nDifferent mechanism; no direct antimicrobial activity<\/td>\n<\/tr>\n
KPV<\/td>\nAnti-inflammatory, immunomodulation<\/td>\nMC1R\/MC3R agonism, cytokine modulation<\/td>\nDifferent mechanism; no direct antimicrobial activity<\/td>\n<\/tr>\n
Defensins (\u03b1\/\u03b2)<\/td>\nAntimicrobial, host defense<\/td>\nMembrane disruption, receptor modulation<\/td>\nDifferent structural class; multiple human isoforms<\/td>\n<\/tr>\n<\/tbody>\n<\/table>\n

Comparatively, LL-37 differs from other antimicrobial peptides in its unique status as the sole human cathelicidin and its pleiotropic host defense activities[reference:33]. On the one hand, LL-37 exerts direct antimicrobial effects through membrane disruption and biofilm inhibition. On the other hand, LL-37 functions as an immunomodulatory peptide, modulating cytokine responses, promoting chemotaxis, and neutralizing LPS[reference:34]. In contrast, defensins represent a different structural class of antimicrobial peptides with multiple human isoforms, while BPC-157 and KPV operate through mechanisms unrelated to antimicrobial activity.<\/p>\n

Research Applications for LL-37 in Switzerland<\/strong><\/h2>\n

Scientists have investigated LL-37 across several research domains:<\/p>\n