FOXO4-DRI (10MG)

What Is FOXO4-DRI and Why Buy It for Research?

Buy FOXO4-DRI 10mg in Switzerland for research into cellular senescence, senolytic mechanisms, and aging pathways. Specifically, FOXO4-DRI (also known as FOXO4 D-Retro-Inverso peptide) is a synthetic 46-amino acid cell-permeable peptide antagonist designed to selectively induce apoptosis in senescent cells. The peptide features a D-retro-inverso (DRI) configuration, meaning it consists entirely of D-amino acid residues arranged in a retro-inverso sequence, which confers enhanced stability and resistance to proteolytic degradation.

Researchers first described FOXO4-DRI in a landmark 2017 study by Baar and colleagues, published in Cell, demonstrating its ability to selectively eliminate senescent cells and restore tissue homeostasis in response to chemotoxicity and aging. Subsequently, beneficial effects of FOXO4-DRI have been demonstrated in various age-related models. In scientific research, FOXO4-DRI serves as a molecular tool for studying cellular senescence, apoptosis pathways, and senolytic interventions. Furthermore, Core Peptides supplies FOXO4-DRI as a lyophilized powder in a 10mg format exclusively for laboratory use. Therefore, researchers seeking to source this compound for their work will find it readily available when they buy FOXO4-DRI 10mg in Switzerland.

FOXO4-DRI Research Overview: Buy FOXO4-DRI 10mg in Switzerland for Senolytic Studies

Centrally, research into FOXO4-DRI has focused on its function as a senolytic agent that selectively targets and eliminates senescent cells. Cellular senescence is a hallmark of aging characterized by irreversible growth arrest and the secretion of pro-inflammatory factors collectively known as the senescence-associated secretory phenotype (SASP). The accumulation of senescent cells contributes to age-related functional decline and various diseases.

FOXO4-DRI targets the FOXO4-p53 axis, which researchers have identified as pivotal in maintaining the viability of senescent cells. The peptide competitively disrupts the interaction between FOXO4 and p53, thereby facilitating the nuclear export of phosphorylated p53 and inducing apoptosis in senescent cells. This mechanism activates the p53/BCL-2/Caspase-3 signaling pathway to promote selective apoptosis of senescent cells.

Notably, structural studies have revealed that the disordered FOXO4-DRI binds to the disordered p53 transactivation domain 2 (p53TAD2) and forms a transiently folded complex. Furthermore, p53 phosphorylation enhances the affinity for both FOXO4 and FOXO4-DRI. Accordingly, researchers who buy FOXO4-DRI 10mg in Switzerland from Core Peptides can support their investigations into cellular senescence, senolytic mechanisms, and aging pathways.

How Does FOXO4-DRI Work in Research?

Mechanistically, FOXO4-DRI’s proposed action involves functioning as a cell-permeable peptide antagonist that disrupts the FOXO4-p53 interaction in senescent cells. The peptide operates through a well-characterized mechanism involving several key steps.

Disruption of FOXO4-p53 Interaction

FOXO4-DRI competitively inhibits the binding of FOXO4 to p53 in senescent cells. In senescent cells, the FOXO4-p53 interaction prevents p53 from inducing apoptosis, thereby maintaining cell viability. By disrupting this interaction, FOXO4-DRI releases p53 from FOXO4 sequestration.

Nuclear Export of Phosphorylated p53

Following FOXO4-p53 disruption, FOXO4-DRI promotes the nuclear export of phosphorylated p53. This nuclear exclusion is a critical step in the senolytic mechanism, as it allows p53 to engage pro-apoptotic pathways in the cytoplasm. Studies have demonstrated that FOXO4-DRI facilitates the nuclear exclusion of upregulated p53-serine 15 phosphorylation.

Activation of Apoptotic Pathways

Once in the cytoplasm, phosphorylated p53 triggers the activation of the p53/BCL-2/Caspase-3 signaling pathway. This cascade involves the upregulation of BAX and activation of cleaved caspase-3, ultimately leading to apoptosis of senescent cells. Studies have shown that FOXO4-DRI treatment increases the apoptosis rate from 10% to 27% in senescent Leydig cells.

D-Retro-Inverso Configuration

FOXO4-DRI consists entirely of D-amino acid residues arranged in a retro-inverso sequence. This DRI configuration provides several advantages for research applications, including enhanced stability and resistance to proteolytic degradation, which allows for more consistent experimental results.

Why Is FOXO4-DRI Studied in Switzerland?

Primarily, researchers study FOXO4-DRI because it represents a well-characterized senolytic peptide that enables investigation of cellular senescence, apoptosis pathways, and aging mechanisms. In fact, this compound offers a focused tool for studying the molecular mechanisms underlying senescent cell clearance, tissue homeostasis, and age-related dysfunction.

Research has demonstrated FOXO4-DRI’s relevance across multiple domains. Injection of FOXO4-DRI in both naturally aged and induced aging mice effectively suppressed aortic aging and improved aortic function. Additionally, FOXO4-DRI alleviates endothelial cell senescence induced by oxygen-glucose deprivation, thereby enhancing endothelial cell function. The peptide has also been shown to improve spermatogenesis in aged mice through reducing senescence-associated secretory phenotype secretion from Leydig cells.

Furthermore, FOXO4-DRI induces apoptosis in keloid senescent fibroblasts by promoting nuclear exclusion of upregulated p53-serine 15 phosphorylation. The peptide has demonstrated efficacy in selectively removing senescent cells from in vitro expanded human chondrocytes. Ultimately, researchers who buy FOXO4-DRI 10mg in Switzerland gain access to a comprehensive research tool for investigating cellular senescence, senolytic mechanisms, and aging pathways.

FOXO4-DRI Research Areas in Laboratory Studies

Research Area	Focus	Evidence Level
Cellular Senescence	Senescent cell clearance, SASP modulation, senescence markers (p16, p21, p53)	Mechanistic / In Vitro / In Vivo
Senolytic Research	Selective apoptosis of senescent cells, senolytic drug development	Preclinical
Vascular Aging	Endothelial cell senescence, aortic aging suppression, vascular function	Animal / Preclinical
Aging and Longevity	Age-related dysfunction, tissue homeostasis, lifespan extension	Preclinical
Apoptosis Signaling	p53/BCL-2/Caspase-3 pathway, nuclear exclusion of p53, BAX activation	Mechanistic / In Vitro
Reproductive Aging	Spermatogenesis, Leydig cell senescence, testosterone secretion	Preclinical
Cartilage and Joint Health	Chondrocyte senescence, osteoarthritis models, cartilage regeneration	In Vitro / Preclinical

FOXO4-DRI Compared With Related Research Compounds

Compound	Research Focus	Mechanism / Target	Key Difference
FOXO4-DRI	Cellular senescence, senolytic research, apoptosis	FOXO4-p53 disruption, p53 nuclear export	46-amino acid D-retro-inverso peptide; selective senolytic
Dasatinib + Quercetin	Senolytic research, aging	Multiple pathways (D+Q combination)	Small molecule drug combination; different mechanism
Navitoclax (ABT-263)	Senolytic research, cancer	BCL-2/BCL-xL inhibition	Small molecule; BCL-2 inhibitor; broader effects
Epithalon (AEDG)	Pineal gland, telomerase activation, anti-aging	Telomerase activation, histone binding	Tetrapeptide; different mechanism; pineal-specific

Comparatively, FOXO4-DRI differs from other senolytic compounds in its mechanism and peptide-based approach. On the one hand, FOXO4-DRI is a D-retro-inverso peptide that specifically targets the FOXO4-p53 interaction in senescent cells. On the other hand, Dasatinib + Quercetin is a small molecule combination with broader mechanisms of action. In contrast, Navitoclax is a BCL-2 inhibitor with different senolytic properties, while Epithalon focuses on telomerase activation rather than senescent cell clearance.

Research Applications for FOXO4-DRI in Switzerland

Scientists have investigated FOXO4-DRI across several research domains:

• Cellular Senescence Research: Researchers use FOXO4-DRI to study senescent cell clearance, senescence markers (p16, p21, p53), and the senescence-associated secretory phenotype (SASP).
• Senolytic Studies: The peptide serves as a tool for investigating selective apoptosis of senescent cells and developing senolytic interventions.
• Vascular Aging Research: Studies have examined FOXO4-DRI’s effects on endothelial cell senescence, aortic aging suppression, and vascular function improvement.
• Aging and Longevity Research: Investigations have explored FOXO4-DRI’s geroprotective effects and potential for restoring tissue homeostasis.
• Apoptosis Signaling Studies: The peptide is used to study p53/BCL-2/Caspase-3 pathway activation and nuclear exclusion of p53.
• Reproductive Research: Studies have investigated FOXO4-DRI’s effects on spermatogenesis and Leydig cell senescence.

Evidently, researchers who buy FOXO4-DRI 10mg in Switzerland gain a valuable addition to any laboratory toolkit focused on cellular senescence, senolytic research, and aging pathways.

FOXO4-DRI Product Specifications

Specification	Details
Product Name	FOXO4-DRI (FOXO4 D-Retro-Inverso)
Alternative Names	FOXO4 DRI peptide, FOXO4-DRI senolytic peptide, FOXO4-p53 antagonist
Amount	10mg
Form	Lyophilized powder
Purity	Not verified (≥95-98% HPLC purity reported by some suppliers)
Peptide Length	46 amino acids
Amino Acid Sequence (Short)	D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
Amino Acid Configuration	D-amino acids (D-retro-inverso)
Molecular Formula	C₂₂₈H₃₈₈N₈₆O₆₄
Molecular Weight	5,358.06 g/mol
CAS Number	2460055-10-9
Research Category	Anti-Aging & Longevity / Cellular Research & Signaling
Research Use	Laboratory research use only
CoA	Available upon request (not verified)
Storage	Lyophilized powder should be stored desiccated at -20°C or below, protected from light
Solubility	Soluble in water (100 mg/mL) and DMSO (50 mg/mL)

How to Evaluate FOXO4-DRI Quality for Research

When sourcing FOXO4-DRI peptide for laboratory research, researchers should consider several quality indicators:

• Identity Confirmation: Analytical techniques such as mass spectrometry should confirm the compound’s molecular weight (5,358.06 g/mol) and D-retro-inverso sequence.
• Purity Assessment: High-performance liquid chromatography (HPLC) should verify purity, with ≥95-98% considered standard for research-grade material.
• D-Amino Acid Confirmation: Analytical methods should confirm the D-retro-inverso configuration, as this is critical for the peptide’s stability and activity.
• Batch Traceability: Lot numbers and batch information enable researchers to track specific production runs.
• Certificate of Analysis: A CoA should accompany the product, detailing analytical testing results including HPLC purity and identity confirmation.
• Labeling Accuracy: Proper labeling should clearly indicate the product name, amount (10mg), sequence, molecular formula, CAS number, and storage recommendations.
• Storage Conditions: Appropriate storage at -20°C or below in desiccated, dark conditions helps maintain peptide stability.

Understanding the Certificate of Analysis

Typically, a Certificate of Analysis (CoA) accompanies research peptides and provides information about the specific batch’s analytical testing. For example, a CoA may include product identity confirmation, purity percentage as determined by HPLC, batch or lot number for traceability, analytical methods used (e.g., mass spectrometry, HPLC), and a physical description of the product.

Nevertheless, it is important to note that a CoA does not establish safety, efficacy, therapeutic effectiveness, or suitability for human use. Instead, it serves as a quality control document that helps researchers verify the identity and purity of the peptide they are using in their laboratory investigations.

Storage and Stability of FOXO4-DRI

Core Peptides supplies FOXO4-DRI as a lyophilized (freeze-dried) powder. To maintain stability and integrity:

• Store the lyophilized powder desiccated at -20°C or below for long-term storage (up to 1 year)
• Store at 4°C for short-term storage if frequent access is required
• Avoid repeated freeze-thaw cycles
• Weigh under dry conditions; the peptide is hygroscopic
• Reconstitute only immediately before use with appropriate sterile solvents (sterile water or DMSO)
• Inject solvent slowly against the inner wall of the vial; avoid vigorous agitation during dissolution
• Filter sterilize if required (e.g., 0.22 µm) immediately prior to use
• Aliquot and store reconstituted solutions at -80°C for up to 6 months or at -20°C for up to 1 month (sealed, away from moisture)
• Protect from light and moisture; prolonged exposure to light, elevated temperature, or aqueous environments may reduce stability

Frequently Asked Questions About Buying FOXO4-DRI 10mg in Switzerland

What is FOXO4-DRI?

Specifically, FOXO4-DRI (FOXO4 D-Retro-Inverso peptide) is a synthetic 46-amino acid cell-permeable peptide antagonist that disrupts the interaction between FOXO4 and p53 in senescent cells, inducing apoptosis. It consists entirely of D-amino acid residues arranged in a retro-inverso sequence.

What is FOXO4-DRI researched for?

Primarily, researchers study FOXO4-DRI for its senolytic properties—the selective elimination of senescent cells. Studies have investigated its effects on cellular senescence, vascular aging, apoptosis signaling, spermatogenesis, and chondrocyte senescence.

How does FOXO4-DRI work?

Mechanistically, FOXO4-DRI functions as a cell-permeable peptide antagonist that competitively disrupts the FOXO4-p53 interaction in senescent cells. This disruption promotes the nuclear export of phosphorylated p53 and activates the p53/BCL-2/Caspase-3 signaling pathway, leading to selective apoptosis of senescent cells.

What is the amino acid sequence of FOXO4-DRI?

The amino acid sequence is D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG) (all D-amino acids).

What is the molecular weight of FOXO4-DRI?

The molecular weight is approximately 5,358.06 g/mol.

What is the molecular formula of FOXO4-DRI?

The molecular formula is C₂₂₈H₃₈₈N₈₆O₆₄.

What is the CAS number of FOXO4-DRI?

The CAS number is 2460055-10-9.

Is FOXO4-DRI synthetic?

Yes, FOXO4-DRI is a synthetic peptide produced through solid-phase peptide synthesis with D-amino acid residues in a retro-inverso configuration.

What research exists on FOXO4-DRI?

Research on FOXO4-DRI includes the landmark 2017 Baar study in Cell demonstrating senolytic effects in mice, studies on vascular aging and endothelial cell senescence, investigations into spermatogenesis and Leydig cell senescence, and research on chondrocyte senescence and cartilage health.

Is FOXO4-DRI approved as a medicine?

No. Regulatory authorities have not approved FOXO4-DRI as a medicine, pharmaceutical, or therapeutic agent. It is a research tool for laboratory use only.

Is FOXO4-DRI intended for human use?

No. FOXO4-DRI is intended for laboratory research use only and is not for human consumption, injection, or therapeutic application.

Where can I buy FOXO4-DRI 10mg in Switzerland?

You can buy FOXO4-DRI 10mg in Switzerland from Core Peptides, a trusted research peptide supplier serving the Swiss scientific community.

How should researchers evaluate FOXO4-DRI quality?

Researchers should look for identity confirmation via mass spectrometry, purity data from HPLC, D-amino acid configuration confirmation, batch traceability, and a Certificate of Analysis.

Related Research Compounds

Researchers interested in FOXO4-DRI may also find the following related compounds relevant to their work:

• Epithalon — A Khavinson tetrapeptide researched for pineal gland function, telomerase activation, and anti-aging.
• BPC-157 — A peptide researched for tissue healing, gastrointestinal protection, and angiogenesis.
• GHK-Cu — A copper-binding peptide researched for skin regeneration, wound healing, and anti-aging applications.
• Thymalin — A peptide researched for immune system modulation and thymus function.

Explore Anti-Aging & Longevity

FOXO4-DRI belongs to the Anti-Aging & Longevity category of research compounds. Anti-Aging & Longevity products are studied for their potential roles in cellular senescence, senolytic mechanisms, and age-related pathway modulation. Generally, researchers who buy FOXO4-DRI 10mg in Switzerland often pair it with related compounds in this category to explore complementary pathways in aging and longevity research.

Explore Cellular Research & Signaling

Researchers studying apoptosis signaling, cellular senescence, and p53 pathways may also find relevant compounds in the Cellular Research & Signaling category. FOXO4-DRI’s interactions with the FOXO4-p53 axis and p53/BCL-2/Caspase-3 pathway make it a valuable tool for investigating fundamental cellular signaling and senescence mechanisms.

Further Research

For researchers seeking to deepen their understanding of FOXO4-DRI and its research applications, the following areas may warrant further investigation:

• The relationship between FOXO4-DRI-mediated FOXO4-p53 disruption and specific downstream effects on senescent cell clearance
• Comparative studies between FOXO4-DRI and other senolytic compounds in various aging and tissue-specific models
• The potential role of FOXO4-DRI in modulating the senescence-associated secretory phenotype (SASP)
• Mechanistic studies on FOXO4-DRI’s interaction with the p53 transactivation domain and its functional consequences for apoptosis
• Exploration of FOXO4-DRI’s effects on different cell types and tissue systems beyond senescent cells

Research Disclaimer

FOXO4-DRI is a research peptide supplied for laboratory research use only. Researchers must not use it for human consumption, injection, or any form of therapeutic application. Moreover, this product is not a medicine, pharmaceutical, or medical device. Furthermore, Swissmedic, the FDA, EMA, or any other regulatory authority have not approved it for human use. Researchers should consult Swissmedic for applicable regulations and guidance on research peptide handling in Switzerland.

Generally, the information provided on this page is for educational and scientific reference purposes only. Therefore, it does not constitute medical advice, treatment recommendations, or dosing instructions. Ultimately, researchers bear the responsibility for ensuring that their use of this product complies with all applicable laws, regulations, and institutional guidelines.

Finally, all research involving peptides should be conducted by qualified personnel in appropriate laboratory settings with proper safety protocols.